PDB entry 1fi3

View 1fi3 on RCSB PDB site
Description: solution structure of the m61h mutant of pseudomonas stutzeri substrain zobell ferrocytochrome c-551
Class: electron transport
Keywords: c-551 family, ELECTRON TRANSPORT
Deposited on 2000-08-03, released 2001-03-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c-551
    Species: Pseudomonas stutzeri ZoBell [TaxId:96564]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00101 (0-81)
      • engineered (60)
    Domains in SCOPe 2.04: d1fi3a_
  • Heterogens: HEC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fi3A (A:)
    qdgealfkskpcaachsvdtkmvgpalkevaaknagvegaadtlalhikngsqgvwgpip
    hppnpvteeeakilaewvlslk