PDB entry 1fi1

View 1fi1 on RCSB PDB site
Description: FhuA in complex with lipopolysaccharide and rifamycin CGP4832
Class: metal transport
Keywords: Outer membrane protein; TonB-dependent receptor; FhuA; siderophore receptor; integral membrane protein; lipopolysaccharide; rifamycin CGP 4832; beta-barrel; antibiotic
Deposited on 2000-08-03, released 2001-08-29
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.233
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferrichrome-iron receptor
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06971 (0-706)
      • intrachain his tag (387-397)
    Domains in SCOP 1.73: d1fi1a_
  • Heterogens: PO4, NI, NA, MG, FTT, DPO, RIF, DDQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fi1A (A:)
    esawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemalhqpksvkealsytpgvsv
    gtrgasntydhliirgfaaegqsqnnylnglklqgnfyndavidpymleraeimrgpvsv
    lygksspggllnmvskrptteplkevqfkagtdslfqtgfdfsdsldddgvysyrltgla
    rsanaqqkgseeqryaiapaftwrpddktnftflsyfqnepetgyygwlpkegtveplpn
    gkrlptdfnegaknntysrnekmvgysfdhefndtftvrqnlrfaenktsqnsvygygvc
    sdpanayskqcaalapadkghylarkyvvddeklqnfsvdtqlqskfatgdidhtlltgv
    dfmrmrndinawfgyddsvpllnlynpsshhhhhhgssvntdfdfnakdpansgpyriln
    kqkqtgvyvqdqaqwdkvlvtlggrydwadqeslnrvagttdkrddkqftwrggvnylfd
    ngvtpyfsysesfepssqvgkdgnifapskgkqyevgvkyvpedrpivvtgavynltktn
    nlmadpegsffsveggeirargveieakaalsasvnvvgsytytdaeyttdttykgntpa
    qvpkhmaslwadytffdgplsgltlgtggrytgssygdpansfkvgsytvvdalvrydla
    rvgmagsnvalhvnnlfdreyvascfntygcfwgaerqvvatatfrf