PDB entry 1fhw

View 1fhw on RCSB PDB site
Description: Structure of the pleckstrin homology domain from GRP1 in complex with inositol(1,3,4,5,6)pentakisphosphate
Class: signaling protein
Keywords: pleckstrin, 3-phosphoinositides, inositol tetrakisphosphate signal transduction protein , guanine nucleotide exchange factor
Deposited on 2000-08-02, released 2000-08-23
The last revision prior to the SCOP 1.75 freeze date was dated 2005-05-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.229
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanine nucleotide exchange factor and integrin binding protein homolog grp1
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • GB AAB60876
    Domains in SCOP 1.75: d1fhwa_
  • Chain 'B':
    Compound: guanine nucleotide exchange factor and integrin binding protein homolog grp1
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • GB AAB60876 (Start-128)
    Domains in SCOP 1.75: d1fhwb_
  • Heterogens: SO4, I5P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fhwA (A:)
    mnpdregwllklggrvktwkrrwfiltdnclyyfeyttdkeprgiiplenlsirevedpr
    kpncfelynpshkgqvikackteadgrvvegnhvvyrisapspeekeewmksikasisrd
    pfydmlatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fhwA (A:)
    pdregwllklggrvktwkrrwfiltdnclyyfeyttdkeprgiiplenlsirevedprkp
    ncfelynpshkgqvikackteadgrvvegnhvvyrisapspeekeewmksikasisrdpf
    yd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fhwB (B:)
    mnpdregwllklggrvktwkrrwfiltdnclyyfeyttdkeprgiiplenlsirevedpr
    kpncfelynpshkgqvikackteadgrvvegnhvvyrisapspeekeewmksikasisrd
    pfydmlatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fhwB (B:)
    dregwllklggrvktwkrrwfiltdnclyyfeyttdkeprgiiplenlsirevedprkpn
    cfelynpshkgqvikackteadgrvvegnhvvyrisapspeekeewmksikasisrdpfy
    dmlatr