PDB entry 1fhu

View 1fhu on RCSB PDB site
Description:
Deposited on 2000-08-02, released 2000-08-23
The last revision prior to the SCOP 1.67 freeze date was dated 2000-12-20, with a file datestamp of 2000-12-20.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.195
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1fhua1, d1fhua2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fhuA (A:)
    mrsaqvyrwqipmdagvvlrdrrlktrdglyvclregeregwgeisplpgfsqetweeaq
    svllawvnnwlagdcelpqmpsvafgvscalaeltdtlpqaanyraaplcngdpddlilk
    ladmpgekvakvkvglyeavrdgmvvnllleaipdlhlrldanrawtplkgqqfakyvnp
    dyrdriafleepcktrddsrafaretgiaiawdeslrepdfafvaeegvravvikptltg
    slekvreqvqaahalgltavisssiesslgltqlariaawltpdtipgldtldlmqaqqv
    rrwpgstlpvvevdalerll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fhuA (A:)
    mrsaqvyrwqipmdlktrdglyvclregeregwgeisplpgfsqetweeaqsvllawvnn
    wlagdcelpqmpsvafgvscalaeltdtlpqaanyraaplcngdekvakvkvglyeavrd
    gmvvnllleaipdlhlrldanrawtplkgqqfakyvnpdyrdriafleepcktrddsraf
    aretgiaiawdeslrepdfafvaeegvravvikptltgslekvreqvqaahalgltavis
    ssiesslgltqlariaawltpdtipgldtldlmqaqqvrrwpgstlpvvevdalerll