PDB entry 1fhs

View 1fhs on RCSB PDB site
Description: the three-dimensional solution structure of the src homology domain-2 of the growth factor receptor bound protein-2, nmr, 18 structures
Class: sh2 domain
Keywords: grb2, sh2 domain, protein nmr, solution structures
Deposited on 1997-06-12, released 1998-06-17
The last revision prior to the SCOP 1.73 freeze date was dated 1998-06-17, with a file datestamp of 2007-06-04.
Experiment type: NMR18
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: growth factor receptor bound protein-2
    Species: HOMO SAPIENS
    Gene: GRB2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fhsa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fhsA (A:)
    giemkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvl
    rdgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqptyvqa