PDB entry 1fhs

View 1fhs on RCSB PDB site
Description: the three-dimensional solution structure of the src homology domain-2 of the growth factor receptor bound protein-2, nmr, 18 structures
Deposited on 1997-06-12, released 1998-06-17
The last revision prior to the SCOP 1.71 freeze date was dated 1998-06-17, with a file datestamp of 1998-06-17.
Experiment type: NMR18
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1fhs__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fhs_ (-)
    giemkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvl
    rdgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqptyvqa