PDB entry 1fhq

View 1fhq on RCSB PDB site
Description: refined solution structure of the fha2 domain of rad53
Class: transferase
Keywords: FHA domain, Rad53, Phosphotyrosine, Phosphoprotein, TRANSFERASE
Deposited on 2000-08-02, released 2000-10-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein kinase spk1
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22216 (0-157)
  Domains in SCOPe 2.08: d1fhqa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fhqA (A:)
  gngrfltlkplpdsiiqesleiqqgvnpffigrsedcnckiednrlsrvhcfifkkrhav
  gksmyespaqglddiwychtgtnvsylnnnrmiqgtkfllqdgdeikiiwdknnkfvigf
  kveindttglfneglgmlqeqrvvlkqtaeekdlvkkl