PDB entry 1fho

View 1fho on RCSB PDB site
Description: Solution Structure of the PH Domain from the C. Elegans Muscle Protein UNC-89
Class: signaling protein
Keywords: Pleckstrin Homology domain, electrostatics, muscle, signal transduction, SIGNALING PROTEIN
Deposited on 2000-08-02, released 2000-10-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: unc-89
  Species: Caenorhabditis elegans [TaxId:6239]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O01761 (1-118)
    • initiating met (0)
  Domains in SCOPe 2.08: d1fhoa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fhoA (A:)
  mgdtgklgriirhdafqvwegdeppklryvflfrnkimfteqdastsppsythyssirld
  kynirqhttdedtivlqpqepglpsfrikpkdfetseyvrkawlrdiaeeqekyaaerd