PDB entry 1fhn

View 1fhn on RCSB PDB site
Description: transthyretin stability as a key factor in amyloidogenesis
Class: transport protein
Keywords: Amyloid, Transthyretin, Protein Stability, TRANSPORT PROTEIN
Deposited on 2000-08-02, released 2001-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.172
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (118)
    Domains in SCOPe 2.07: d1fhna_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (118)
    Domains in SCOPe 2.07: d1fhnb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fhnA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystma
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fhnA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysystmavvtn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fhnB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystma
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fhnB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysystmavvtn