PDB entry 1fhj

View 1fhj on RCSB PDB site
Description: crystal structure of aquomet hemoglobin-I of the maned wolf (chrysocyon brachyurus) at 2.0 resolution.
Class: oxygen storage/transport
Keywords: maned wolf, hemoglobin, metahemoglobin, x-ray diffraction, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2000-08-01, released 2001-08-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.194
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin (alpha chain)
    Species: Chrysocyon brachyurus [TaxId:68728]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01952 (0-140)
      • see remark 999 (129)
    Domains in SCOPe 2.04: d1fhja_
  • Chain 'B':
    Compound: hemoglobin (beta chain)
    Species: Chrysocyon brachyurus [TaxId:68728]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1fhjb_
  • Chain 'C':
    Compound: hemoglobin (alpha chain)
    Species: Chrysocyon brachyurus [TaxId:68728]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01952 (0-140)
      • see remark 999 (129)
    Domains in SCOPe 2.04: d1fhjc_
  • Chain 'D':
    Compound: hemoglobin (beta chain)
    Species: Chrysocyon brachyurus [TaxId:68728]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1fhjd_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fhjA (A:)
    vlspadktnikstwdkigghagdyggealdrtfqsfpttktyfphfdlspgsaqvkahgk
    kvadalttavahlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpteftpa
    vhasldkfftavstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fhjB (B:)
    vhltaeekslvsglwgkvnvdevggealgrllivypwtqrffdsfgdlstpdavmsnakv
    kahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgk
    eftpqvqaayqkvvagvanalahkyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fhjC (C:)
    vlspadktnikstwdkigghagdyggealdrtfqsfpttktyfphfdlspgsaqvkahgk
    kvadalttavahlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpteftpa
    vhasldkfftavstvltskyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fhjD (D:)
    vhltaeekslvsglwgkvnvdevggealgrllivypwtqrffdsfgdlstpdavmsnakv
    kahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgk
    eftpqvqaayqkvvagvanalahkyh