PDB entry 1fhj

View 1fhj on RCSB PDB site
Description: crystal structure of aquomet hemoglobin-i of the maned wolf (chrysocyon brachyurus) at 2.0 resolution.
Deposited on 2000-08-01, released 2001-08-01
The last revision prior to the SCOP 1.63 freeze date was dated 2001-08-01, with a file datestamp of 2001-08-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.194
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1fhja_
  • Chain 'B':
    Domains in SCOP 1.63: d1fhjb_
  • Chain 'C':
    Domains in SCOP 1.63: d1fhjc_
  • Chain 'D':
    Domains in SCOP 1.63: d1fhjd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fhjA (A:)
    vlspadktnikstwdkigghagdyggealdrtfqsfpttktyfphfdlspgsaqvkahgk
    kvadalttavahlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpteftpa
    vhasldkfftavstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fhjB (B:)
    vhltaeekslvsglwgkvnvdevggealgrllivypwtqrffdsfgdlstpdavmsnakv
    kahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgk
    eftpqvqaayqkvvagvanalahkyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fhjC (C:)
    vlspadktnikstwdkigghagdyggealdrtfqsfpttktyfphfdlspgsaqvkahgk
    kvadalttavahlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpteftpa
    vhasldkfftavstvltskyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fhjD (D:)
    vhltaeekslvsglwgkvnvdevggealgrllivypwtqrffdsfgdlstpdavmsnakv
    kahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgk
    eftpqvqaayqkvvagvanalahkyh