PDB entry 1fhi

View 1fhi on RCSB PDB site
Description: substrate analog (ib2) complex with the fragile histidine triad protein, fhit
Class: nucleotide-binding protein
Keywords: nucleotide-binding protein, cancer, diadenosine triphosphate hydrolase, histidine triad, tumor suppressor
Deposited on 1997-12-11, released 1998-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.241
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fragile histidine triad protein
    Species: Homo sapiens [TaxId:9606]
    Gene: FHIT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fhia_
  • Heterogens: IB2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1fhiA (A:)
msfrfgqhlikpsvvflktelsfalvnrkpvvpghvlvcplrpverfhdlrpdevadlfq
ttqrvgtvvekhfhgtsltfsmqdgpeagqtvkhvhvhvlprkagdfhrndsiyeelqkh
dkedfpaswrseeemaaeaaalrvyfq

    Sequence, based on observed residues (ATOM records): (download) 
    >1fhiA (A:)
sfrfgqhlikpsvvflktelsfalvnrkpvvpghvlvcplrpverfhdlrpdevadlfqt
tqrvgtvvekhfhgtsltfsmqdgpeagqtvkhvhvhvlprkagdswrseeemaaeaaal
rvyfq