PDB entry 1fhg

View 1fhg on RCSB PDB site
Description: high resolution refinement of telokin
Class: contractile protein
Keywords: immunoglobulin fold, beta barrel, CONTRACTILE PROTEIN
Deposited on 2000-08-01, released 2000-08-23
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: telokin
    Species: Meleagris gallopavo [TaxId:9103]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56276
      • see remark 999 (51)
    Domains in SCOPe 2.02: d1fhga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fhgA (A:)
    isgmsgrkasgssptspinankvenedafleevaeekphvkpyftktildmevvegsaar
    fdckvegypdpevmwfkddnpvkesrhfqidydeegncsltisevcgdddakytckavns
    lgeatctaellvetmgkegegegegeedeeeeee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fhgA (A:)
    aeekphvkpyftktildmevvegsaarfdckvegypdpevmwfkddnpvkesrhfqidyd
    eegncsltisevcgdddakytckavnslgeatctaellvetm