PDB entry 1fhg

View 1fhg on RCSB PDB site
Description: high resolution refinement of telokin
Deposited on 2000-08-01, released 2000-08-23
The last revision prior to the SCOP 1.57 freeze date was dated 2000-08-23, with a file datestamp of 2000-08-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1fhga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fhgA (A:)
aeekphvkpyftktildmevvegsaarfdckvegypdpevmwfkddnpvkesrhfqidyd
eegncsltisevcgdddakytckavnslgeatctaellvetm