PDB entry 1fhe

View 1fhe on RCSB PDB site
Description: glutathione transferase (fh47) from fasciola hepatica
Class: transferase
Keywords: transferase, detoxification, glutathione transferase
Deposited on 1997-07-24, released 1998-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.237
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione transferase
    Species: Fasciola hepatica [TaxId:6192]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fhea1, d1fhea2
  • Heterogens: GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fheA (A:)
    paklgywklrglaqpvrlfleylgeeyeehlygrddrekwmsekfnmgldlpnlpyyidd
    kckltqsvaimryiadkhgmlgttpeerarismiegaamdlrigfgrvcynpkfeevkee
    yvkelpktlkmwsdflgdrhyltgssvshvdfmlyetldsirylaphcldefpklkefks
    riealpkikaymeskrfikwplngwaasfgagdapps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fheA (A:)
    paklgywklrglaqpvrlfleylgeeyeehlygrddrekwmsekfnmgldlpnlpyyidd
    kckltqsvaimryiadkhgmlgttpeerarismiegaamdlrigfgrvcynpkfeevkee
    yvkelpktlkmwsdflgdrhyltgssvshvdfmlyetldsirylaphcldefpklkefks
    riealpkikaymeskrfikwplngwaasfgagda