PDB entry 1fhb

View 1fhb on RCSB PDB site
Description: three-dimensional solution structure of the cyanide adduct of a met80ala variant of saccharomyces cerevisiae iso-1-cytochrome c. identification of ligand-residue interactions in the distal heme cavity
Class: electron transport
Keywords: electron transport
Deposited on 1995-06-16, released 1995-09-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ferricytochrome c
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00044 (0-107)
    • conflict (43)
    • conflict (84)
    • conflict (106)
  Domains in SCOPe 2.08: d1fhba_
• Heterogens: CYN, HEM

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fhbA (A:)
  tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrqsgqaegysytdanikk
  nvlwdennmseyltnpkkyipgtkaafgglkkekdrndlitylkkase