PDB entry 1fh5

View 1fh5 on RCSB PDB site
Description: crystal structure of the fab fragment of the monoclonal antibody mak33
Class: immune system
Keywords: Fab, BiP, IMMUNE SYSTEM
Deposited on 2000-07-31, released 2000-09-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.198
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: monoclonal antibody mak33
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1FH5 (0-197)
    Domains in SCOPe 2.05: d1fh5h1, d1fh5h2
  • Chain 'L':
    Compound: monoclonal antibody mak33
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1FH5 (0-212)
    Domains in SCOPe 2.05: d1fh5l1, d1fh5l2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fh5H (H:)
    sggglvkpagslklscaasgftfssyymywvrqtpdkrlewvatisdggsytyypdsvkg
    rftisrdnaknnlylqmsslksedtamyycardamdywgqgtlvtvsaakttppsvypla
    vtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvtsstwpsetvtc
    nvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fh5L (L:)
    divltqspatlsvtpgesvslscrasqsisnnlhwyqqkshesprllikyasqsisgips
    rfsgsgsgtdftlsinsvetedfgmyycqqsnswpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne