PDB entry 1fh3

View 1fh3 on RCSB PDB site
Description: nmr structures of lqh III alpha-like scorpion toxin from leiurus quinquestriatus corresponding to the major conformer in solution
Class: toxin
Keywords: alpha-like toxin, scorpion toxin, sodium channel inhibitor non-proline cis peptide bond, cis-trans isomerism
Deposited on 2000-07-31, released 2000-08-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lqh III alpha-like toxin
    Species: Leiurus quinquestriatus hebraeus [TaxId:6884]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fh3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fh3A (A:)
    vrdgyiaqpencvyhcfpgssgcdtlckekggtsghcgfkvghglacwcnalpdnvgiiv
    egekchs