PDB entry 1fh0

View 1fh0 on RCSB PDB site
Description: crystal structure of human cathepsin v complexed with an irreversible vinyl sulfone inhibitor
Class: HYDROLASE/HYDROLASE inhibitor
Keywords: cathepsin, papain, protease, cancer, HYDROLASE-HYDROLASE inhibitor complex
Deposited on 2000-07-30, released 2001-07-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin v
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60911
      • engineered (107)
      • engineered (178)
    Domains in SCOPe 2.07: d1fh0a_
  • Chain 'B':
    Compound: cathepsin v
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60911 (0-220)
      • engineered (107)
      • engineered (178)
    Domains in SCOPe 2.07: d1fh0b_
  • Heterogens: 0IW, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fh0A (A:)
    lpksvdwrkkgyvtpvknqkqcgscwafsatgalegqmfrktgklvslseqnlvdcsrpq
    gnqgcnggfmarafqyvkenggldseesypyvavdeickyrpensvaqdtgftvvapgke
    kalmkavatvgpisvamdaghssfqfyksgiyfepdcssknldhgvlvvgygfegansdn
    skywlvknswgpewgsngyvkiakdknnhcgiataasypnv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fh0B (B:)
    lpksvdwrkkgyvtpvknqkqcgscwafsatgalegqmfrktgklvslseqnlvdcsrpq
    gnqgcnggfmarafqyvkenggldseesypyvavdeickyrpensvaqdtgftvvapgke
    kalmkavatvgpisvamdaghssfqfyksgiyfepdcssknldhgvlvvgygfegansdn
    skywlvknswgpewgsngyvkiakdknnhcgiataasypnv