PDB entry 1fgv

View 1fgv on RCSB PDB site
Description: x-ray structures of fragments from binding and nonbinding versions of a humanized anti-cd18 antibody: structural indications of the key role of vh residues 59 to 65
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1993-11-01, released 1994-01-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.18
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: h52 fv (heavy chain)
    Database cross-references and differences (RAF-indexed):
    • PDB 1FGV (0-123)
    Domains in SCOPe 2.03: d1fgvh_
  • Chain 'L':
    Compound: h52 fv (light chain)
    Database cross-references and differences (RAF-indexed):
    • GB AAB24132 (0-106)
      • conflict (29)
      • conflict (52)
      • conflict (95)
      • conflict (99)
    Domains in SCOPe 2.03: d1fgvl_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1fgvH (H:)
    evqlvesggglvqpggslrlscatsgytfteytmhwmrqapgkglewvaginpknggtsy
    adsvkgrftisvdkskntlylqmnslraedtavyycarwrglnygfdvryfdvwgqgtlv
    tvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fgvH (H:)
    evqlvesggglvqpggslrlscatsgytfteytmhwmrqapgkglewvaginpknggtsy
    adsvkgrftisvdkskntlylqmnslraedtavyycarwrgldvryfdvwgqgtlvtvss
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1fgvL (L:)
    diqmtqspsslsasvgdrvtitcrasqdinnylnwyqqkpgkapklliyytstlesgvps
    rfsgsgsgtdytltisslqpedfatyycqqgntlpptfgagtkveikrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fgvL (L:)
    diqmtqspsslsasvgdrvtitcrasqdinnylnwyqqkpgkapklliyytstlesgvps
    rfsgsgsgtdytltisslqpedfatyycqqgntlpptfgagtkveik