PDB entry 1fgv

View 1fgv on RCSB PDB site
Description:
Deposited on 1993-11-01, released 1994-01-31
The last revision prior to the SCOP 1.69 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.18
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1fgvh_
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1fgvl_

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1fgvH (H:)
    evqlvesggglvqpggslrlscatsgytfteytmhwmrqapgkglewvaginpknggtsy
    adsvkgrftisvdkskntlylqmnslraedtavyycarwrglnygfdvryfdvwgqgtlv
    tvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fgvH (H:)
    evqlvesggglvqpggslrlscatsgytfteytmhwmrqapgkglewvaginpknggtsy
    adsvkgrftisvdkskntlylqmnslraedtavyycarwrgldvryfdvwgqgtlvtvss
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1fgvL (L:)
    diqmtqspsslsasvgdrvtitcrasqdinnylnwyqqkpgkapklliyytstlesgvps
    rfsgsgsgtdytltisslqpedfatyycqqgntlpptfgagtkveikrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fgvL (L:)
    diqmtqspsslsasvgdrvtitcrasqdinnylnwyqqkpgkapklliyytstlesgvps
    rfsgsgsgtdytltisslqpedfatyycqqgntlpptfgagtkveik