PDB entry 1fgu

View 1fgu on RCSB PDB site
Description: ssdna-binding domain of the large subunit of replication protein a
Deposited on 2000-07-28, released 2001-02-07
The last revision prior to the SCOP 1.55 freeze date was dated 2001-02-14, with a file datestamp of 2001-02-14.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.215
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fguA (A:)
    mskvvpiasltpyqskwticarvtnksqirtwsnsrgegklfslelvdesgeiratafne
    qvdkffplievnkvyyfskgtlkiankqftavkndyemtfnnetsvmpceddhhlptvqf
    dftgiddlenkskdslvdiigicksyedatkitvrsnnrevakrniylmdtsgkvvtatl
    wgedadkfdgsrqpvlaikgarvsdfggrslsvlssstiianpdipeayklrgwfdaegq
    aldgvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fguB (B:)
    mskvvpiasltpyqskwticarvtnksqirtwsnsrgegklfslelvdesgeiratafne
    qvdkffplievnkvyyfskgtlkiankqftavkndyemtfnnetsvmpceddhhlptvqf
    dftgiddlenkskdslvdiigicksyedatkitvrsnnrevakrniylmdtsgkvvtatl
    wgedadkfdgsrqpvlaikgarvsdfggrslsvlssstiianpdipeayklrgwfdaegq
    aldgvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fguB (B:)
    mskvvpiasltpyqskwticarvtnksqirtwsnsrgegklfslelvdesgeiratafne
    qvdkffplievnkvyyfskgtlkiankqftavkndyemtfnnetsvmpcvqfdftgiddl
    enkskdslvdiigicksyedatkitvrsnnrevakrniylmdtsgkvvtatlwgedadkf
    dgsrqpvlaikgarvsdfggrslsvlssstiianpdipeayklrgwfdaegqaldgvs