PDB entry 1fgr

View 1fgr on RCSB PDB site
Description: lipoxygenase-1 (soybean) at 100k, q697e mutant
Deposited on 2000-07-28, released 2001-07-04
The last revision prior to the SCOP 1.57 freeze date was dated 2001-07-18, with a file datestamp of 2001-07-18.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.196
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fgrA (A:)
    hkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgkdtfle
    gintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtirf
    vcnswvyntklyksvriffanhtyvpsetpaplvsyreeelkslrgngtgerkeydriyd
    ydvyndlgnpdkseklarpvlggsstfpyprrgrtgrgptvtdpntekqgevfyvprden
    lghlkskdaleigtkslsqivqpafesafdlkstpiefhsfqdvhdlyeggiklprdvis
    tiiplpvikelyrtdgqhilkfpqphvvqvsqsawmtdeefaremiagvnpcvirgleef
    ppksnldpaiygdqsskitadsldldgytmdealgsrrlfmldyhdifmpyvrqinqlns
    aktyatrtilflredgtlkpvaielslphsagdlsaavsqvvlpakegvestiwllakay
    vivndscyhqlmshwlnthaamepfviathrhlsvlhpiyklltphyrnnmninalarqs
    linangiiettflpskysvemssavyknwvftdqalpadlikrgvaikdpstphgvrlli
    edypyaadgleiwaaiktwvqeyvplyyardddvkndselqhwwkeavekghgdlkdkpw
    wpklqtledlvevcliiiwiasalhaavnfgeypygglimnrptasrrllpekgtpeyee
    minnhekaylrtitsklptlislsvieilsthasdevylgqrdnphwtsdskalqafqkf
    gnklkeieeklvrrnndpslqgnrlgpvqlpytllypsseegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fgrA (A:)
    hkikgtvvlmpknelenlnaflgrsvslqlisatkadahgkgkvgkdtflegintslptl
    gagesafnihfewdgsmgipgafyiknymqvefflksltleaitirfvcnswvyntklyk
    svriffanhtyvpsetpaplvsyreeelkslrgngtgerkeydriydydvyndlgnpdks
    eklarpvlggsstfpyprrgrtgrgptvtdpntekqgevfyvprdenlghlkskdaleig
    tkslsqivqpafesafdlkstpiefhsfqdvhdlyeggiklprdvistiiplpvikelyr
    tdgqhilkfpqphvvqvsqsawmtdeefaremiagvnpcvirgleefppksnldpaiygd
    qsskitadsldldgytmdealgsrrlfmldyhdifmpyvrqinqlnsaktyatrtilflr
    edgtlkpvaielslphsagdlsaavsqvvlpakegvestiwllakayvivndscyhqlms
    hwlnthaamepfviathrhlsvlhpiyklltphyrnnmninalarqslinangiiettfl
    pskysvemssavyknwvftdqalpadlikrgvaikdpstphgvrlliedypyaadgleiw
    aaiktwvqeyvplyyardddvkndselqhwwkeavekghgdlkdkpwwpklqtledlvev
    cliiiwiasalhaavnfgeypygglimnrptasrrllpekgtpeyeeminnhekaylrti
    tsklptlislsvieilsthasdevylgqrdnphwtsdskalqafqkfgnklkeieeklvr
    rnndpslqgnrlgpvqlpytllypsseegltfrgipnsisi