PDB entry 1fgn

View 1fgn on RCSB PDB site
Description: monoclonal murine antibody 5g9-anti-human tissue factor
Class: immunoglobulin
Keywords: antibody, fab, anti-tf, monoclonal, murine, immunoglobulin
Deposited on 1997-04-10, released 1998-02-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.217
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin fab 5g9
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR S49220 (2-213)
      • conflict (2)
      • conflict (4-5)
      • conflict (12-13)
      • conflict (16)
      • conflict (22)
      • conflict (31)
      • conflict (49)
      • conflict (53)
      • conflict (56-58)
      • conflict (66)
      • conflict (68)
      • conflict (75)
      • conflict (96)
      • conflict (98-99)
      • conflict (101-104)
    Domains in SCOPe 2.03: d1fgnh1, d1fgnh2
  • Chain 'L':
    Compound: immunoglobulin fab 5g9
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAB16765 (0-213)
      • conflict (29-30)
      • conflict (33)
      • conflict (35)
      • conflict (40)
      • conflict (49)
      • conflict (51-52)
      • conflict (54)
      • conflict (79-80)
      • conflict (82-84)
      • conflict (90-91)
      • conflict (93)
      • conflict (106)
    Domains in SCOPe 2.03: d1fgnl1, d1fgnl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fgnH (H:)
    eiqlqqsgaelvrpgalvklsckasgfnikdyymhwvkqrpeqglewiglidpengntiy
    dpkfqgkasitadtssntaylqlssltsedtavyycardnsyyfdywgqgttltvssakt
    tppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
    lsssvtvpsstwpsetvtcnvahpasstkvdkki
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fgnL (L:)
    dikmtqspssmyaslgervtitckasqdirkylnwyqqkpwkspktliyyatsladgvps
    rfsgsgsgqdysltisslesddtatyyclqhgespytfgggtkleinradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec