PDB entry 1fgm

View 1fgm on RCSB PDB site
Description: lipoxygenase-1 (soybean) at 100k, n694h mutant
Class: oxidoreductase
Keywords: dioxygenase, lipoxygenase, metalloprotein, fatty acids, oxidoreductase
Deposited on 2000-07-28, released 2001-10-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.178
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: seed lipoxygenase-1
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08170 (Start-838)
      • engineered (693)
    Domains in SCOPe 2.06: d1fgma1, d1fgma2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fgmA (A:)
    mfsaghkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgk
    dtflegintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnq
    gtirfvcnswvyntklyksvriffanhtyvpsetpaplvsyreeelkslrgngtgerkey
    driydydvyndlgnpdkseklarpvlggsstfpyprrgrtgrgptvtdpntekqgevfyv
    prdenlghlkskdaleigtkslsqivqpafesafdlkstpiefhsfqdvhdlyeggiklp
    rdvistiiplpvikelyrtdgqhilkfpqphvvqvsqsawmtdeefaremiagvnpcvir
    gleefppksnldpaiygdqsskitadsldldgytmdealgsrrlfmldyhdifmpyvrqi
    nqlnsaktyatrtilflredgtlkpvaielslphsagdlsaavsqvvlpakegvestiwl
    lakayvivndscyhqlmshwlnthaamepfviathrhlsvlhpiyklltphyrnnmnina
    larqslinangiiettflpskysvemssavyknwvftdqalpadlikrgvaikdpstphg
    vrlliedypyaadgleiwaaiktwvqeyvplyyardddvkndselqhwwkeavekghgdl
    kdkpwwpklqtledlvevcliiiwiasalhaavhfgqypygglimnrptasrrllpekgt
    peyeeminnhekaylrtitsklptlislsvieilsthasdevylgqrdnphwtsdskalq
    afqkfgnklkeieeklvrrnndpslqgnrlgpvqlpytllypsseegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fgmA (A:)
    kikgtvvlmpknelnlnaflgrsvslqlisatkadahgkgkvgkdtflegintslptlga
    gesafnihfewdgsmgipgafyiknymqvefflksltleatirfvcnswvyntklyksvr
    iffanhtyvpsetpaplvsyreeelkslrgngtgerkeydriydydvyndlgnpdksekl
    arpvlggsstfpyprrgrtgrgptvtdpntekqgevfyvprdenlghlkskdaleigtks
    lsqivqpafesafdlkstpiefhsfqdvhdlyeggiklprdvistiiplpvikelyrtdg
    qhilkfpqphvvqvsqsawmtdeefaremiagvnpcvirgleefppksnldpaiygdqss
    kitadsldldgytmdealgsrrlfmldyhdifmpyvrqinqlnsaktyatrtilflredg
    tlkpvaielslphsagdlsaavsqvvlpakegvestiwllakayvivndscyhqlmshwl
    nthaamepfviathrhlsvlhpiyklltphyrnnmninalarqslinangiiettflpsk
    ysvemssavyknwvftdqalpadlikrgvaikdpstphgvrlliedypyaadgleiwaai
    ktwvqeyvplyyardddvkndselqhwwkeavekghgdlkdkpwwpklqtledlvevcli
    iiwiasalhaavhfgqypygglimnrptasrrllpekgtpeyeeminnhekaylrtitsk
    lptlislsvieilsthasdevylgqrdnphwtsdskalqafqkfgnklkeieeklvrrnn
    dpslqgnrlgpvqlpytllypsseegltfrgipnsisi