PDB entry 1fgl

View 1fgl on RCSB PDB site
Description: Cyclophilin A complexed with a fragment of HIV-1 GAG protein
Class: isomerase/viral protein
Keywords: cyclophilin, binding protein for cyclosporin a, aids, isomerase-peptide complex, isomerase-viral protein complex
Deposited on 1996-11-18, released 1997-04-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.195
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclophilin a
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1fgla_
  • Chain 'B':
    Compound: hiv-1 gag protein
    Species: Human immunodeficiency virus type 1 [TaxId:11705]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fglA (A:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'B':
    No sequence available.