PDB entry 1fgl

View 1fgl on RCSB PDB site
Description: cyclophilin a complexed with a fragment of hiv-1 gag protein
Class: complex (isomerase/peptide)
Keywords: cyclophilin, binding protein for cyclosporin a, aids, complex (isomerase/peptide)
Deposited on 1996-11-18, released 1997-04-01
The last revision prior to the SCOP 1.75 freeze date was dated 1997-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.195
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclophilin a
    Species: HOMO SAPIENS
    Gene: CYCLOPHILIN
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1fgla_
  • Chain 'B':
    Compound: hiv-1 gag protein
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05889
      • modified residue (15)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fglA (A:)
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

  • Chain 'B':
    No sequence available.