PDB entry 1fgg

View 1fgg on RCSB PDB site
Description: crystal structure of 1,3-glucuronyltransferase I (glcat-I) complexed with gal-gal-xyl, udp, and mn2+
Class: transferase
Keywords: glucuronyltransferase, UDP, DDD
Deposited on 2000-07-28, released 2001-01-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.188
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucuronyltransferase I
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94766 (1-260)
      • initiating methionine (0)
      • conflict (129)
    Domains in SCOPe 2.06: d1fgga1, d1fgga2
  • Chain 'B':
    Compound: glucuronyltransferase I
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94766 (1-260)
      • initiating methionine (0)
      • conflict (129)
    Domains in SCOPe 2.06: d1fggb_
  • Heterogens: MN, UDP, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fggA (A:)
    mtiyvvtptyarlvqkaelvrlsqtlslvprlhwllvedaegptplvsgllaasgllfth
    lvvltpkaqrlregepgwvhprgveqrnkaldwlrgrggavggekdppppgtqgvvyfad
    ddntysrelfeemrwtrgvsvwpvglvgglrfegpqvqdgrvvgfhtawepsrpfpvdma
    gfavalpllldkpnaqfdstaprghlessllshlvdpkdlepraanctrvlvwhtrtekp
    kmkqeeqlqrqgrgsdpaiev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fggA (A:)
    mtiyvvtptyarlvqkaelvrlsqtlslvprlhwllvedaegptplvsgllaasgllfth
    lvvltpwvhprgveqrnkaldwlrgrggavggekdppppgtqgvvyfadddntysrelfe
    emrwtrgvsvwpvglvgglrfegpqvqdgrvvgfhtawepsrpfpvdmagfavalpllld
    kpnaqfdstaprghlessllshlvdpkdlepraanctrvlvwhtrtekpkmkqeeqlqrq
    grgsdpaiev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fggB (B:)
    mtiyvvtptyarlvqkaelvrlsqtlslvprlhwllvedaegptplvsgllaasgllfth
    lvvltpkaqrlregepgwvhprgveqrnkaldwlrgrggavggekdppppgtqgvvyfad
    ddntysrelfeemrwtrgvsvwpvglvgglrfegpqvqdgrvvgfhtawepsrpfpvdma
    gfavalpllldkpnaqfdstaprghlessllshlvdpkdlepraanctrvlvwhtrtekp
    kmkqeeqlqrqgrgsdpaiev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fggB (B:)
    mtiyvvtptyarlvqkaelvrlsqtlslvprlhwllvedaegptplvsgllaasgllfth
    lvvltphprgveqrnkaldwlrgrggavggekdppppgtqgvvyfadddntysrelfeem
    rwtrgvsvwpvglvgglrfegpqvqdgrvvgfhtawerpfpvdmagfavalpllldkpna
    qfdstaprghlessllshlvdpkdlepraanctrvlvwhtrtekpkmkqeeqlqrqgrgs
    dpaiev