PDB entry 1fgc

View 1fgc on RCSB PDB site
Description: structural implications of drug resistant mutants of hiv-1 protease: high resolution crystal structures of the mutant protease/substrate analog complexes
Class: hydrolase/hydrolase inhibitor
Keywords: hiv-1 protease, mutant, dimer, inhibitor
Deposited on 2000-07-28, released 2001-06-01
The last revision prior to the SCOP 1.75 freeze date was dated 2001-06-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.212
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: peptide inhibitor (ace)ti(nle)(nle)qr
  Species: synthetic, synthetic
  
• Chain 'C':
  Compound: protease retropepsin
  Species: Human immunodeficiency virus 1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04587
    • engineered (6)
    • engineered (32)
    • engineered (62)
    • engineered (66)
    • engineered (94)
  Domains in SCOP 1.75: d1fgcc_
• Chain 'D':
  Compound: protease retropepsin
  Species: Human immunodeficiency virus 1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04587 (0-98)
    • engineered (6)
    • engineered (32)
    • engineered (62)
    • engineered (66)
    • engineered (94)
  Domains in SCOP 1.75: d1fgcd_
• Heterogens: ACE, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fgcC (C:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fgcD (D:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf