PDB entry 1fgb

View 1fgb on RCSB PDB site
Description: toxin
Class: enterotoxin
Keywords: cholera toxin, choleragenoid, enterotoxin, ADP-ribosylation
Deposited on 1996-02-21, released 1996-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.171
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: cholera toxin b subunit pentamer
    Species: Vibrio cholerae [TaxId:44104]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01556 (0-102)
      • conflict (17)
      • conflict (46)
    Domains in SCOPe 2.08: d1fgbd_
  • Chain 'E':
    Compound: cholera toxin b subunit pentamer
    Species: Vibrio cholerae [TaxId:44104]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01556 (0-102)
      • conflict (17)
      • conflict (46)
    Domains in SCOPe 2.08: d1fgbe_
  • Chain 'F':
    Compound: cholera toxin b subunit pentamer
    Species: Vibrio cholerae [TaxId:44104]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01556 (0-102)
      • conflict (17)
      • conflict (46)
    Domains in SCOPe 2.08: d1fgbf_
  • Chain 'G':
    Compound: cholera toxin b subunit pentamer
    Species: Vibrio cholerae [TaxId:44104]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01556 (0-102)
      • conflict (17)
      • conflict (46)
    Domains in SCOPe 2.08: d1fgbg_
  • Chain 'H':
    Compound: cholera toxin b subunit pentamer
    Species: Vibrio cholerae [TaxId:44104]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01556 (0-102)
      • conflict (17)
      • conflict (46)
    Domains in SCOPe 2.08: d1fgbh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fgbD (D:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fgbE (E:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fgbF (F:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fgbG (G:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fgbH (H:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman