PDB entry 1fg9

View 1fg9 on RCSB PDB site
Description: 3:1 complex of interferon-gamma receptor with interferon-gamma dimer
Class: immune system
Keywords: cytokine-receptor complex, fibronectin type-III, IMMUNE SYSTEM
Deposited on 2000-07-28, released 2000-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.237
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interferon gamma
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01579 (1-End)
      • initiating met (0)
    Domains in SCOPe 2.07: d1fg9a_
  • Chain 'B':
    Compound: interferon gamma
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01579 (1-End)
      • initiating met (0)
    Domains in SCOPe 2.07: d1fg9b_
  • Chain 'C':
    Compound: interferon-gamma receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fg9c1, d1fg9c2
  • Chain 'D':
    Compound: interferon-gamma receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fg9d1, d1fg9d2
  • Chain 'E':
    Compound: interferon-gamma receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fg9e1, d1fg9e2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fg9A (A:)
    mqdpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfkn
    fkddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmae
    lspaaktgkrkrsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fg9A (A:)
    mqdpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfkn
    fkddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmae
    lspaakt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fg9B (B:)
    mqdpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfkn
    fkddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmae
    lspaaktgkrkrsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fg9B (B:)
    mqdpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfkn
    fkddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmae
    lspaakt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fg9C (C:)
    emgtadlgpssvptptnvtiesynmnpivyweyqimpqvpvftvevknygvknsewidac
    inishhycnisdhvgdpsnslwvrvkarvgqkesayakseefavcrdgkigppkldirke
    ekqimidifhpsvfvngdeqevdydpettcyirvynvyvrmngseiqykiltqkeddcde
    iqcqlaipvsslnsqycvsaegvlhvwgvttekskevcitifnssikgslwipvvaalll
    flvls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fg9C (C:)
    vptptnvtiesynmnpivyweyqimpqvpvftvevknygvknsewidacinishhycnis
    dhvgdpsnslwvrvkarvgqkesayakseefavcrdgkigppkldirkeekqimidifhp
    svfvngdeqedpettcyirvynvyvrmngseiqykiltqkeddcdeiqcqlaipvsslns
    qycvsaegvlhvwgvttekskevcitifns
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fg9D (D:)
    emgtadlgpssvptptnvtiesynmnpivyweyqimpqvpvftvevknygvknsewidac
    inishhycnisdhvgdpsnslwvrvkarvgqkesayakseefavcrdgkigppkldirke
    ekqimidifhpsvfvngdeqevdydpettcyirvynvyvrmngseiqykiltqkeddcde
    iqcqlaipvsslnsqycvsaegvlhvwgvttekskevcitifnssikgslwipvvaalll
    flvls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fg9D (D:)
    svptptnvtiesynmnpivyweyqimpqvpvftvevknygvknsewidacinishhycni
    sdhvgdpsnslwvrvkarvgqkesayakseefavcrdgkigppkldirkeekqimidifh
    psvfvngdeqettcyirvynvyvrmngseiqykiltqkeddcdeiqcqlaipvsslnsqy
    cvsaegvlhvwgvttekskevciti
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1fg9E (E:)
    emgtadlgpssvptptnvtiesynmnpivyweyqimpqvpvftvevknygvknsewidac
    inishhycnisdhvgdpsnslwvrvkarvgqkesayakseefavcrdgkigppkldirke
    ekqimidifhpsvfvngdeqevdydpettcyirvynvyvrmngseiqykiltqkeddcde
    iqcqlaipvsslnsqycvsaegvlhvwgvttekskevcitifnssikgslwipvvaalll
    flvls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fg9E (E:)
    ptptnvtiesynmnpivyweyqimpqvpvftvevknygvknsewidacinishhycnisd
    hvgdpsnslwvrvkarvgqkesaseefavcrdgkigppkldirkeekqimidifhpspet
    tcyirvynvyvrmngseiqykiltqkeddcdeiqcqlaipvsslnsqycvsaegvlhvwg
    vttekskevciti