PDB entry 1fg8

View 1fg8 on RCSB PDB site
Description: structural implications of drug resistant mutants of hiv-1 protease: high resolution crystal structures of the mutant protease/substrate analog complexes
Class: hydrolase/hydrolase inhibitor
Keywords: hiv-1 protease, hydrolase-hydrolase inhibitor complex
Deposited on 2000-07-25, released 2001-06-01
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.223
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'C':
  Compound: protease retropepsin
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04587
    • engineered (6)
    • engineered (32)
    • engineered (62)
    • engineered (66)
    • engineered (87)
    • engineered (94)
  Domains in SCOPe 2.02: d1fg8c_
• Chain 'D':
  Compound: protease retropepsin
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04587 (0-98)
    • engineered (6)
    • engineered (32)
    • engineered (62)
    • engineered (66)
    • engineered (87)
    • engineered (94)
  Domains in SCOPe 2.02: d1fg8d_
• Heterogens: 0Q4, HOH

PDB Chain Sequences:

• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fg8C (C:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrdlltqigatlnf
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fg8D (D:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrdlltqigatlnf