PDB entry 1fg8

View 1fg8 on RCSB PDB site
Description: structural implications of drug resistant mutants of hiv-1 protease: high resolution crystal structures of the mutant protease/substrate analog complexes
Class: hydrolase/hydrolase inhibitor
Keywords: hiv-1 protease, hydrolase-hydrolase inhibitor complex
Deposited on 2000-07-25, released 2001-06-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.223
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: protease retropepsin
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587
      • engineered (6)
      • engineered (32)
      • engineered (62)
      • engineered (66)
      • engineered (87)
      • engineered (94)
    Domains in SCOPe 2.08: d1fg8c_
  • Chain 'D':
    Compound: protease retropepsin
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-98)
      • engineered (6)
      • engineered (32)
      • engineered (62)
      • engineered (66)
      • engineered (87)
      • engineered (94)
    Domains in SCOPe 2.08: d1fg8d_
  • Heterogens: 0Q4, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fg8C (C:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrdlltqigatlnf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fg8D (D:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrdlltqigatlnf