PDB entry 1fg7

View 1fg7 on RCSB PDB site
Description: crystal structure of l-histidinol phosphate aminotransferase with pyridoxal-5'-phosphate
Class: transferase
Keywords: Aminotransferase, HisC, Histidine Biosynthesis, Pyridoxal Phosphate, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, Structural Genomics, TRANSFERASE
Deposited on 2000-07-28, released 2001-08-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.205
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histidinol phosphate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06986 (Start-355)
      • modified residue (111)
      • modified residue (236)
      • modified residue (264)
    Domains in SCOPe 2.06: d1fg7a_
  • Heterogens: PMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fg7A (A:)
    mstvtitdlarenvrnltpyqsarrlggngdvwlnaneyptavefqltqqtlnrypecqp
    kavienyaqyagvkpeqvlvsrgadegiellirafcepgkdailycpptygmysvsaeti
    gvecrtvptldnwqldlqgisdkldgvkvvyvcspnnptgqlinpqdfrtlleltrgkai
    vvadeayiefcpqaslagwlaeyphlailrtlskafalaglrcgftlaneevinllmkvi
    apyplstpvadiaaqalspqgivamrervaqiiaereyliaalkeipcveqvfdsetnyi
    larfkassavfkslwdqgiilrdqnkqpslsgclritvgtreesqrvidalraeqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fg7A (A:)
    tvtitdlarenvrnltpyqsarrlggngdvwlnaneyptavefqltqqtlnrypecqpka
    vienyaqyagvkpeqvlvsrgadegiellirafcepgkdailycpptygmysvsaetigv
    ecrtvptldnwqldlqgisdkldgvkvvyvcspnnptgqlinpqdfrtlleltrgkaivv
    adeayiefcpqaslagwlaeyphlailrtlskafalaglrcgftlaneevinllmkviap
    yplstpvadiaaqalspqgivamrervaqiiaereyliaalkeipcveqvfdsetnyila
    rfkassavfkslwdqgiilrdqnkqpslsgclritvgtreesqrvidalraeqv