PDB entry 1fg6

View 1fg6 on RCSB PDB site
Description: structural implications of drug resistant mutants of hiv-1 protease: high resolution crystal structures of the mutant protease/substrate analog complexes
Deposited on 2000-07-25, released 2001-06-01
The last revision prior to the SCOP 1.69 freeze date was dated 2001-06-01, with a file datestamp of 2001-06-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.219
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Domains in SCOP 1.69: d1fg6c_
  • Chain 'D':
    Domains in SCOP 1.69: d1fg6d_

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fg6C (C:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrdlltqigatlnf

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fg6D (D:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrdlltqigatlnf