PDB entry 1fg3

View 1fg3 on RCSB PDB site
Description: crystal structure of l-histidinol phosphate aminotransferase complexed with l-histidinol
Deposited on 2000-07-27, released 2001-08-22
The last revision prior to the SCOP 1.69 freeze date was dated 2001-08-22, with a file datestamp of 2001-08-22.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1fg3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fg3A (A:)
    mstvtitdlarenvrnltpyqsarrlggngdvwlnaneyptavefqltqqtlnrypecqp
    kavienyaqyagvkpeqvlvsrgadegiellirafcepgkdailycpptygmysvsaeti
    gvecrtvptldnwqldlqgisdkldgvkvvyvcspnnptgqlinpqdfrtlleltrgkai
    vvadeayiefcpqaslagwlaeyphlailrtlskafalaglrcgftlaneevinllmkvi
    apyplstpvadiaaqalspqgivamrervaqiiaereyliaalkeipcveqvfdsetnyi
    larfkassavfkslwdqgiilrdqnkqpslsgclritvgtreesqrvidalraeqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fg3A (A:)
    tvtitdlarenvrnltpyqsarrlggngdvwlnaneyptavefqltqqtlnrypecqpka
    vienyaqyagvkpeqvlvsrgadegiellirafcepgkdailycpptygmysvsaetigv
    ecrtvptldnwqldlqgisdkldgvkvvyvcspnnptgqlinpqdfrtlleltrgkaivv
    adeayiefcpqaslagwlaeyphlailrtlskafalaglrcgftlaneevinllmkviap
    yplstpvadiaaqalspqgivamrervaqiiaereyliaalkeipcveqvfdsetnyila
    rfkassavfkslwdqgiilrdqnkqpslsgclritvgtreesqrvidalraeqv