PDB entry 1fg3

View 1fg3 on RCSB PDB site
Description: crystal structure of l-histidinol phosphate aminotransferase complexed with l-histidinol
Class: transferase
Keywords: Aminotransferase, HisC, Histidine biosynthesis, Pyridoxal Phosphate, TRANSFERASE
Deposited on 2000-07-27, released 2001-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histidinol phosphate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06986 (Start-355)
      • modified residue (111)
      • modified residue (236)
      • modified residue (264)
    Domains in SCOPe 2.07: d1fg3a_
  • Heterogens: PLP, HSA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fg3A (A:)
    mstvtitdlarenvrnltpyqsarrlggngdvwlnaneyptavefqltqqtlnrypecqp
    kavienyaqyagvkpeqvlvsrgadegiellirafcepgkdailycpptygmysvsaeti
    gvecrtvptldnwqldlqgisdkldgvkvvyvcspnnptgqlinpqdfrtlleltrgkai
    vvadeayiefcpqaslagwlaeyphlailrtlskafalaglrcgftlaneevinllmkvi
    apyplstpvadiaaqalspqgivamrervaqiiaereyliaalkeipcveqvfdsetnyi
    larfkassavfkslwdqgiilrdqnkqpslsgclritvgtreesqrvidalraeqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fg3A (A:)
    tvtitdlarenvrnltpyqsarrlggngdvwlnaneyptavefqltqqtlnrypecqpka
    vienyaqyagvkpeqvlvsrgadegiellirafcepgkdailycpptygmysvsaetigv
    ecrtvptldnwqldlqgisdkldgvkvvyvcspnnptgqlinpqdfrtlleltrgkaivv
    adeayiefcpqaslagwlaeyphlailrtlskafalaglrcgftlaneevinllmkviap
    yplstpvadiaaqalspqgivamrervaqiiaereyliaalkeipcveqvfdsetnyila
    rfkassavfkslwdqgiilrdqnkqpslsgclritvgtreesqrvidalraeqv