PDB entry 1fg2

View 1fg2 on RCSB PDB site
Description: crystal structure of the lcmv peptidic epitope gp33 in complex with the murine class i mhc molecule h-2db
Deposited on 2000-07-27, released 2000-10-04
The last revision prior to the SCOP 1.67 freeze date was dated 2000-10-04, with a file datestamp of 2000-10-04.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.236
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fg2A (A:)
    mgphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpey
    weretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfaye
    grdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatl
    lrtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdg
    tfqkwasvvvplgkeqnytcrvyheglpepltlrwepppst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fg2A (A:)
    phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
    retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
    dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
    tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
    qkwasvvvplgkeqnytcrvyheglpepltlrw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fg2B (B:)
    miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
    wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fg2B (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fg2D (D:)
    mgphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpey
    weretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfaye
    grdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatl
    lrtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdg
    tfqkwasvvvplgkeqnytcrvyheglpepltlrwepppst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fg2D (D:)
    phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
    retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
    dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
    tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
    qkwasvvvplgkeqnytcrvyheglpepltlrw
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1fg2E (E:)
    miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
    wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fg2E (E:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1fg2G (G:)
    mgphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpey
    weretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfaye
    grdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatl
    lrtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdg
    tfqkwasvvvplgkeqnytcrvyheglpepltlrwepppst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fg2G (G:)
    phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
    retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
    dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
    tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
    qkwasvvvplgkeqnytcrvyheglpepltlrw
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1fg2H (H:)
    miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
    wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fg2H (H:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1fg2J (J:)
    mgphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpey
    weretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfaye
    grdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatl
    lrtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdg
    tfqkwasvvvplgkeqnytcrvyheglpepltlrwepppst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fg2J (J:)
    phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
    retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
    dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
    tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
    qkwasvvvplgkeqnytcrvyheglpepltlrw
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1fg2K (K:)
    miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
    wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fg2K (K:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm