PDB entry 1ffy

View 1ffy on RCSB PDB site
Description: insights into editing from an ile-trna synthetase structure with trna(ile) and mupirocin
Deposited on 2000-07-26, released 2000-08-07
The last revision prior to the SCOP 1.59 freeze date was dated 2000-08-07, with a file datestamp of 2000-08-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.239
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffyA (A:)
    mdyektllmpktdfpmrgglpnkepqiqekwdaedqyhkaleknkgnetfilhdgppyan
    gnlhmghalnkilkdfivryktmqgfyapyvpgwdthglpieqaltkkgvdrkkmstaef
    rekckefaleqielqkkdfrrlgvrgdfndpyitlkpeyeaaqirifgemadkgliykgk
    kpvywspssesslaeaeieyhdkrsasiyvafnvkddkgvvdadakfiiwtttpwtipsn
    vaitvhpelkygqynvngekyiiaealsdavaealdwdkasiklekeytgkelewvvaqh
    pfldreslvingdhvttdagtgcvhtapghgeddyivgqqyelpvispiddkgvfteegg
    qfegmfydkankavtdlltekgallkldfithsyphdwrtkkpvifratpqwfasiskvr
    qdildaientnfkvnwgktriynmvrdrgewvisrqrvwgvplpvfyaengeiimtketv
    nhvadlfaehgsniwfereakdllpegfthpgspngtftketdimdvwfdsgsshrgvle
    trpelsfpadmylegsdqyrgwfnssittsvatrgvspykfllshgfvmdgegkkmsksl
    gnvivpdqvvkqkgadiarlwvsstdyladvrisdeilkqtsddyrkirntlrfmlgnin
    dfnpdtdsipesellevdryllnrlreftastinnyenfdylniyqevqnfinvelsnfy
    ldygkdilyieqrdshirrsmqtvlyqilvdmtkllapilvhtaeevwshtphvkeesvh
    ladmpkvvevdqalldkwrtfmnlrddvnraletarnekvigksleakvtiasndkfnas
    efltsfdalhqlfivsqvkvvdklddqatayehgdiviehadgekcercwnysedlgavd
    elthlcprcqqvvkslv