PDB entry 1ffx

View 1ffx on RCSB PDB site
Description: tubulin:stathmin-like domain complex
Class: structural protein
Keywords: alpha-tubulin, beta-tubulin, stathmin, microtubule, tubulin, structural protein
Deposited on 2000-07-26, released 2000-09-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.95 Å
R-factor: 0.267
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (tubulin)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ffxa_
  • Chain 'B':
    Compound: protein (tubulin)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ffxb_
  • Chain 'C':
    Compound: protein (tubulin)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ffxc_
  • Chain 'D':
    Compound: protein (tubulin)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ffxd_
  • Chain 'E':
    Compound: protein (stathmin-like domain of rb3)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 1FFX (0-90)
    Domains in SCOPe 2.01: d1ffxe_
  • Heterogens: GTP, GDP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ffxA (A:)
    mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
    hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
    rirkladqctglqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
    vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssita
    slrfdgalnvdltefqtnlvpyprahfplatyapvisaekayheqlsvaeitnacfepan
    qmvkcdprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepp
    tvvpggdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefse
    aredmaalekdyeevgvdsvegegeeegeey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ffxA (A:)
    mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddavfvdleptvide
    vrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldrirkladqctglqgfsv
    fhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstavvepynsiltthttleh
    sdcafmvdneaiydicrrnldierptytnlnrligqivssitaslrfdgalnvdltefqt
    nlvpyprahfplatyapvisaekayheqlsvaeitnacfepanqmvkcdprhgkymaccl
    lyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepptvvpggdlakvqravcm
    lsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedmaalekdyeevgv
    dsv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ffxB (B:)
    mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyv
    prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
    rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvv
    epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
    rfpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmm
    aacdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprg
    lkmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvs
    eyqqyqdatadeqgefeeegeedea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ffxB (B:)
    mreivhiqagqcgnqigakfwevisdehgidvyyneaagnkyvprailvdlepgtmdsvr
    sgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvrkesescdclqgfqlth
    slgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvvepynatlsvhqlventd
    etycidnealydicfrtlklttptygdlnhlvsatmsgvttclrfpgqlnadlrklavnm
    vpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaacdprhgryltvaavf
    rgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfignstaiqel
    fkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ffxC (C:)
    mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
    hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
    rirkladqctglqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
    vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssita
    slrfdgalnvdltefqtnlvpyprahfplatyapvisaekayheqlsvaeitnacfepan
    qmvkcdprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepp
    tvvpggdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefse
    aredmaalekdyeevgvdsvegegeeegeey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ffxC (C:)
    mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddavfvdleptvide
    vrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldrirkladqctglqgfsv
    fhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstavvepynsiltthttleh
    sdcafmvdneaiydicrrnldierptytnlnrligqivssitaslrfdgalnvdltefqt
    nlvpyprahfplatyapvisaekayheqlsvaeitnacfepanqmvkcdprhgkymaccl
    lyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepptvvpggdlakvqravcm
    lsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedmaalekdyeevgv
    dsv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ffxD (D:)
    mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyv
    prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
    rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvv
    epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
    rfpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmm
    aacdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprg
    lkmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvs
    eyqqyqdatadeqgefeeegeedea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ffxD (D:)
    mreivhiqagqcgnqigakfwevisdehgidvyyneaagnkyvprailvdlepgtmdsvr
    sgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvrkesescdclqgfqlth
    slgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvvepynatlsvhqlventd
    etycidnealydicfrtlklttptygdlnhlvsatmsgvttclrfpgqlnadlrklavnm
    vpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaacdprhgryltvaavf
    rgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfignstaiqel
    fkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqd
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffxE (E:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx