PDB entry 1ffv

View 1ffv on RCSB PDB site
Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava
Class: hydrolase
Keywords: hydrolase, dehydrogenase
Deposited on 2000-07-26, released 2000-09-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.209
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cuts, iron-sulfur protein of carbon monoxide dehydrogenase
    Species: Hydrogenophaga pseudoflava [TaxId:47421]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19915
      • conflict (89)
    Domains in SCOPe 2.04: d1ffva1, d1ffva2
  • Chain 'B':
    Compound: cutl, molybdoprotein of carbon monoxide dehydrogenase
    Species: Hydrogenophaga pseudoflava [TaxId:47421]
    Database cross-references and differences (RAF-indexed):
    • GB AAD00363 (Start-802)
      • conflict (18-23)
      • modified (383-384)
      • conflict (455)
    Domains in SCOPe 2.04: d1ffvb1, d1ffvb2
  • Chain 'C':
    Compound: cutm, flavoprotein of carbon monoxide dehydrogenase
    Species: Hydrogenophaga pseudoflava [TaxId:47421]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19914 (0-286)
      • conflict (119)
      • conflict (88)
      • conflict (118)
      • conflict (225)
      • conflict (227-231)
    Domains in SCOPe 2.04: d1ffvc1, d1ffvc2
  • Chain 'D':
    Compound: cuts, iron-sulfur protein of carbon monoxide dehydrogenase
    Species: Hydrogenophaga pseudoflava [TaxId:47421]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19915
      • conflict (89)
    Domains in SCOPe 2.04: d1ffvd1, d1ffvd2
  • Chain 'E':
    Compound: cutl, molybdoprotein of carbon monoxide dehydrogenase
    Species: Hydrogenophaga pseudoflava [TaxId:47421]
    Database cross-references and differences (RAF-indexed):
    • GB AAD00363 (Start-802)
      • conflict (18-23)
      • modified (383-384)
      • conflict (455)
    Domains in SCOPe 2.04: d1ffve1, d1ffve2
  • Chain 'F':
    Compound: cutm, flavoprotein of carbon monoxide dehydrogenase
    Species: Hydrogenophaga pseudoflava [TaxId:47421]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19914 (0-286)
      • conflict (119)
      • conflict (88)
      • conflict (118)
      • conflict (225)
      • conflict (227-231)
    Domains in SCOPe 2.04: d1ffvf1, d1ffvf2
  • Heterogens: FES, PCD, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ffvA (A:)
    makkiitvnvngkaqekaveprtllihflreelnltgahigcetshcgactvdidgrsvk
    scthlavqcdgsevltveglankgvlhavqegfykehglqcgfctpgmlmrayrflqenp
    npteaeirmgmtgnlcrctgyqnivkavqyaarklqepstaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ffvA (A:)
    kkiitvnvngkaqekaveprtllihflreelnltgahigcetshcgactvdidgrsvksc
    thlavqcdgsevltveglankgvlhavqegfykehglqcgfctpgmlmrayrflqenpnp
    teaeirmgmtgnlcrctgyqnivkavqyaarklqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ffvB (B:)
    mnapvqdaearelalagmgasrlrkedarfiqgkgnyvddikmpgmlhmdivrapiahgr
    ikkihkdaalampgvhavltaedlkplklhwmptlagdvaavladekvhfqmqevaivia
    ddryiaadaveavkveydelpvvidpidalkpdapvlredlagktsgahgprehhnhift
    wgagdkaatdavfanapvtvsqhmyyprvhpcpletcgcvasfdpikgdlttyitsqaph
    vvrtvvsmlsgipeskvrivspdigggfgnkvgiypgyvcaivasivlgrpvkwvedrve
    nisttafardyhmdgelaatpdgkilglrvnvvadhgafdacadptkfpaglfhicsgsy
    diprahcsvkgvytnkapggvayrcsfrvteavyliermvdvlaqklnmdkaeiraknfi
    rkeqfpyttqfgfeydsgdyhtalkkvldavdypalraeqaarradpnsptlmgiglvtf
    tevvgagpskmcdilgvgmfdsceirihptgsaiarmgtitqgqghqttyaqiiatelgi
    pseviqveegdtstapyglgtygsrstpvagaaialaarkihakarkiaahmlevnendl
    dwevdrfkvkgddskfktmadiawqayhqppaglepgleavhyydppnftypfgiylcvv
    didratgetkvrrfyalddcgtrinpmiiegqihggltegyavamgqqmpfdaqgnllgn
    tlmdyflptavetphwetdhtvtpsphhpigakgvaesphvgsiptftaavvdafahvgv
    thldmphtsyrvwkslkehnlal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ffvB (B:)
    daearelalagmgasrlrkedarfiqgkgnyvddikmpgmlhmdivrapiahgrikkihk
    daalampgvhavltaedlkplklhwmptlagdvaavladekvhfqmqevaiviaddryia
    adaveavkveydelpvvidpidalkpdapvlredlagktsgahgprehhnhiftwgagdk
    aatdavfanapvtvsqhmyyprvhpcpletcgcvasfdpikgdlttyitsqaphvvrtvv
    smlsgipeskvrivspdigggfgnkvgiypgyvcaivasivlgrpvkwvedrvenistta
    fardyhmdgelaatpdgkilglrvnvvadhgafdacadptkfpaglfhicsgsydiprah
    csvkgvytnkapggvayrcsfrvteavyliermvdvlaqklnmdkaeiraknfirkeqfp
    yttqfgfeydsgdyhtalkkvldavdypalraeqaarradpnsptlmgiglvtftevvga
    gpskmcdilgvgmfdsceirihptgsaiarmgtitqgqghqttyaqiiatelgipseviq
    veegdtstapyglgtygsrstpvagaaialaarkihakarkiaahmlevnendldwevdr
    fkvkgddskfktmadiawqayhqppaglepgleavhyydppnftypfgiylcvvdidrat
    getkvrrfyalddcgtrinpmiiegqihggltegyavamgqqmpfdaqgnllgntlmdyf
    lptavetphwetdhtvtpsphhpigakgvaesphvgsiptftaavvdafahvgvthldmp
    htsyrvwkslkehnlal
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffvC (C:)
    mipprfeyhapksvgeavallgqlgsdakllagghsllpmmklrfaqpehlidinripel
    rgireegstvvigamtvendlisspivqarlpllaeaakliadpqvrnrgtiggdiahgd
    pgndhpalsiaveahfvlegpngrrtvpadgfflgtymtlleenevmveirvpafaqgtg
    wayeklkrktgdwatagcavvmrksgntvshirialtnvaptalraeaaeaallgkaftk
    eavqaaadaaiaicepaedlrgdadyktamagqmvkralnaawarca
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ffvD (D:)
    makkiitvnvngkaqekaveprtllihflreelnltgahigcetshcgactvdidgrsvk
    scthlavqcdgsevltveglankgvlhavqegfykehglqcgfctpgmlmrayrflqenp
    npteaeirmgmtgnlcrctgyqnivkavqyaarklqepstaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ffvD (D:)
    akkiitvnvngkaqekaveprtllihflreelnltgahigcetshcgactvdidgrsvks
    cthlavqcdgsevltveglankgvlhavqegfykehglqcgfctpgmlmrayrflqenpn
    pteaeirmgmtgnlcrctgyqnivkavqyaarklqe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ffvE (E:)
    mnapvqdaearelalagmgasrlrkedarfiqgkgnyvddikmpgmlhmdivrapiahgr
    ikkihkdaalampgvhavltaedlkplklhwmptlagdvaavladekvhfqmqevaivia
    ddryiaadaveavkveydelpvvidpidalkpdapvlredlagktsgahgprehhnhift
    wgagdkaatdavfanapvtvsqhmyyprvhpcpletcgcvasfdpikgdlttyitsqaph
    vvrtvvsmlsgipeskvrivspdigggfgnkvgiypgyvcaivasivlgrpvkwvedrve
    nisttafardyhmdgelaatpdgkilglrvnvvadhgafdacadptkfpaglfhicsgsy
    diprahcsvkgvytnkapggvayrcsfrvteavyliermvdvlaqklnmdkaeiraknfi
    rkeqfpyttqfgfeydsgdyhtalkkvldavdypalraeqaarradpnsptlmgiglvtf
    tevvgagpskmcdilgvgmfdsceirihptgsaiarmgtitqgqghqttyaqiiatelgi
    pseviqveegdtstapyglgtygsrstpvagaaialaarkihakarkiaahmlevnendl
    dwevdrfkvkgddskfktmadiawqayhqppaglepgleavhyydppnftypfgiylcvv
    didratgetkvrrfyalddcgtrinpmiiegqihggltegyavamgqqmpfdaqgnllgn
    tlmdyflptavetphwetdhtvtpsphhpigakgvaesphvgsiptftaavvdafahvgv
    thldmphtsyrvwkslkehnlal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ffvE (E:)
    daearelalagmgasrlrkedarfiqgkgnyvddikmpgmlhmdivrapiahgrikkihk
    daalampgvhavltaedlkplklhwmptlagdvaavladekvhfqmqevaiviaddryia
    adaveavkveydelpvvidpidalkpdapvlredlagktsgahgprehhnhiftwgagdk
    aatdavfanapvtvsqhmyyprvhpcpletcgcvasfdpikgdlttyitsqaphvvrtvv
    smlsgipeskvrivspdigggfgnkvgiypgyvcaivasivlgrpvkwvedrvenistta
    fardyhmdgelaatpdgkilglrvnvvadhgafdacadptkfpaglfhicsgsydiprah
    csvkgvytnkapggvayrcsfrvteavyliermvdvlaqklnmdkaeiraknfirkeqfp
    yttqfgfeydsgdyhtalkkvldavdypalraeqaarradpnsptlmgiglvtftevvga
    gpskmcdilgvgmfdsceirihptgsaiarmgtitqgqghqttyaqiiatelgipseviq
    veegdtstapyglgtygsrstpvagaaialaarkihakarkiaahmlevnendldwevdr
    fkvkgddskfktmadiawqayhqppaglepgleavhyydppnftypfgiylcvvdidrat
    getkvrrfyalddcgtrinpmiiegqihggltegyavamgqqmpfdaqgnllgntlmdyf
    lptavetphwetdhtvtpsphhpigakgvaesphvgsiptftaavvdafahvgvthldmp
    htsyrvwkslkehnlal
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffvF (F:)
    mipprfeyhapksvgeavallgqlgsdakllagghsllpmmklrfaqpehlidinripel
    rgireegstvvigamtvendlisspivqarlpllaeaakliadpqvrnrgtiggdiahgd
    pgndhpalsiaveahfvlegpngrrtvpadgfflgtymtlleenevmveirvpafaqgtg
    wayeklkrktgdwatagcavvmrksgntvshirialtnvaptalraeaaeaallgkaftk
    eavqaaadaaiaicepaedlrgdadyktamagqmvkralnaawarca