PDB entry 1ffv

View 1ffv on RCSB PDB site
Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava
Deposited on 2000-07-26, released 2000-09-15
The last revision prior to the SCOP 1.71 freeze date was dated 2000-09-15, with a file datestamp of 2000-09-15.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.209
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ffvA (A:)
    makkiitvnvngkaqekaveprtllihflreelnltgahigcetshcgactvdidgrsvk
    scthlavqcdgsevltveglankgvlhavqegfykehglqcgfctpgmlmrayrflqenp
    npteaeirmgmtgnlcrctgyqnivkavqyaarklqepstaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ffvA (A:)
    kkiitvnvngkaqekaveprtllihflreelnltgahigcetshcgactvdidgrsvksc
    thlavqcdgsevltveglankgvlhavqegfykehglqcgfctpgmlmrayrflqenpnp
    teaeirmgmtgnlcrctgyqnivkavqyaarklqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ffvB (B:)
    mnapvqdaearelalagmgasrlrkedarfiqgkgnyvddikmpgmlhmdivrapiahgr
    ikkihkdaalampgvhavltaedlkplklhwmptlagdvaavladekvhfqmqevaivia
    ddryiaadaveavkveydelpvvidpidalkpdapvlredlagktsgahgprehhnhift
    wgagdkaatdavfanapvtvsqhmyyprvhpcpletcgcvasfdpikgdlttyitsqaph
    vvrtvvsmlsgipeskvrivspdigggfgnkvgiypgyvcaivasivlgrpvkwvedrve
    nisttafardyhmdgelaatpdgkilglrvnvvadhgafdacadptkfpaglfhicsgsy
    diprahcsvkgvytnkapggvayrcsfrvteavyliermvdvlaqklnmdkaeiraknfi
    rkeqfpyttqfgfeydsgdyhtalkkvldavdypalraeqaarradpnsptlmgiglvtf
    tevvgagpskmcdilgvgmfdsceirihptgsaiarmgtitqgqghqttyaqiiatelgi
    pseviqveegdtstapyglgtygsrstpvagaaialaarkihakarkiaahmlevnendl
    dwevdrfkvkgddskfktmadiawqayhqppaglepgleavhyydppnftypfgiylcvv
    didratgetkvrrfyalddcgtrinpmiiegqihggltegyavamgqqmpfdaqgnllgn
    tlmdyflptavetphwetdhtvtpsphhpigakgvaesphvgsiptftaavvdafahvgv
    thldmphtsyrvwkslkehnlal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ffvB (B:)
    daearelalagmgasrlrkedarfiqgkgnyvddikmpgmlhmdivrapiahgrikkihk
    daalampgvhavltaedlkplklhwmptlagdvaavladekvhfqmqevaiviaddryia
    adaveavkveydelpvvidpidalkpdapvlredlagktsgahgprehhnhiftwgagdk
    aatdavfanapvtvsqhmyyprvhpcpletcgcvasfdpikgdlttyitsqaphvvrtvv
    smlsgipeskvrivspdigggfgnkvgiypgyvcaivasivlgrpvkwvedrvenistta
    fardyhmdgelaatpdgkilglrvnvvadhgafdacadptkfpaglfhicsgsydiprah
    csvkgvytnkapggvayrcsfrvteavyliermvdvlaqklnmdkaeiraknfirkeqfp
    yttqfgfeydsgdyhtalkkvldavdypalraeqaarradpnsptlmgiglvtftevvga
    gpskmcdilgvgmfdsceirihptgsaiarmgtitqgqghqttyaqiiatelgipseviq
    veegdtstapyglgtygsrstpvagaaialaarkihakarkiaahmlevnendldwevdr
    fkvkgddskfktmadiawqayhqppaglepgleavhyydppnftypfgiylcvvdidrat
    getkvrrfyalddcgtrinpmiiegqihggltegyavamgqqmpfdaqgnllgntlmdyf
    lptavetphwetdhtvtpsphhpigakgvaesphvgsiptftaavvdafahvgvthldmp
    htsyrvwkslkehnlal
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffvC (C:)
    mipprfeyhapksvgeavallgqlgsdakllagghsllpmmklrfaqpehlidinripel
    rgireegstvvigamtvendlisspivqarlpllaeaakliadpqvrnrgtiggdiahgd
    pgndhpalsiaveahfvlegpngrrtvpadgfflgtymtlleenevmveirvpafaqgtg
    wayeklkrktgdwatagcavvmrksgntvshirialtnvaptalraeaaeaallgkaftk
    eavqaaadaaiaicepaedlrgdadyktamagqmvkralnaawarca
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ffvD (D:)
    makkiitvnvngkaqekaveprtllihflreelnltgahigcetshcgactvdidgrsvk
    scthlavqcdgsevltveglankgvlhavqegfykehglqcgfctpgmlmrayrflqenp
    npteaeirmgmtgnlcrctgyqnivkavqyaarklqepstaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ffvD (D:)
    akkiitvnvngkaqekaveprtllihflreelnltgahigcetshcgactvdidgrsvks
    cthlavqcdgsevltveglankgvlhavqegfykehglqcgfctpgmlmrayrflqenpn
    pteaeirmgmtgnlcrctgyqnivkavqyaarklqe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ffvE (E:)
    mnapvqdaearelalagmgasrlrkedarfiqgkgnyvddikmpgmlhmdivrapiahgr
    ikkihkdaalampgvhavltaedlkplklhwmptlagdvaavladekvhfqmqevaivia
    ddryiaadaveavkveydelpvvidpidalkpdapvlredlagktsgahgprehhnhift
    wgagdkaatdavfanapvtvsqhmyyprvhpcpletcgcvasfdpikgdlttyitsqaph
    vvrtvvsmlsgipeskvrivspdigggfgnkvgiypgyvcaivasivlgrpvkwvedrve
    nisttafardyhmdgelaatpdgkilglrvnvvadhgafdacadptkfpaglfhicsgsy
    diprahcsvkgvytnkapggvayrcsfrvteavyliermvdvlaqklnmdkaeiraknfi
    rkeqfpyttqfgfeydsgdyhtalkkvldavdypalraeqaarradpnsptlmgiglvtf
    tevvgagpskmcdilgvgmfdsceirihptgsaiarmgtitqgqghqttyaqiiatelgi
    pseviqveegdtstapyglgtygsrstpvagaaialaarkihakarkiaahmlevnendl
    dwevdrfkvkgddskfktmadiawqayhqppaglepgleavhyydppnftypfgiylcvv
    didratgetkvrrfyalddcgtrinpmiiegqihggltegyavamgqqmpfdaqgnllgn
    tlmdyflptavetphwetdhtvtpsphhpigakgvaesphvgsiptftaavvdafahvgv
    thldmphtsyrvwkslkehnlal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ffvE (E:)
    daearelalagmgasrlrkedarfiqgkgnyvddikmpgmlhmdivrapiahgrikkihk
    daalampgvhavltaedlkplklhwmptlagdvaavladekvhfqmqevaiviaddryia
    adaveavkveydelpvvidpidalkpdapvlredlagktsgahgprehhnhiftwgagdk
    aatdavfanapvtvsqhmyyprvhpcpletcgcvasfdpikgdlttyitsqaphvvrtvv
    smlsgipeskvrivspdigggfgnkvgiypgyvcaivasivlgrpvkwvedrvenistta
    fardyhmdgelaatpdgkilglrvnvvadhgafdacadptkfpaglfhicsgsydiprah
    csvkgvytnkapggvayrcsfrvteavyliermvdvlaqklnmdkaeiraknfirkeqfp
    yttqfgfeydsgdyhtalkkvldavdypalraeqaarradpnsptlmgiglvtftevvga
    gpskmcdilgvgmfdsceirihptgsaiarmgtitqgqghqttyaqiiatelgipseviq
    veegdtstapyglgtygsrstpvagaaialaarkihakarkiaahmlevnendldwevdr
    fkvkgddskfktmadiawqayhqppaglepgleavhyydppnftypfgiylcvvdidrat
    getkvrrfyalddcgtrinpmiiegqihggltegyavamgqqmpfdaqgnllgntlmdyf
    lptavetphwetdhtvtpsphhpigakgvaesphvgsiptftaavvdafahvgvthldmp
    htsyrvwkslkehnlal
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffvF (F:)
    mipprfeyhapksvgeavallgqlgsdakllagghsllpmmklrfaqpehlidinripel
    rgireegstvvigamtvendlisspivqarlpllaeaakliadpqvrnrgtiggdiahgd
    pgndhpalsiaveahfvlegpngrrtvpadgfflgtymtlleenevmveirvpafaqgtg
    wayeklkrktgdwatagcavvmrksgntvshirialtnvaptalraeaaeaallgkaftk
    eavqaaadaaiaicepaedlrgdadyktamagqmvkralnaawarca