PDB entry 1ffu

View 1ffu on RCSB PDB site
Description:
Deposited on 2000-07-26, released 2000-09-15
The last revision prior to the SCOP 1.63 freeze date was dated 2000-11-13, with a file datestamp of 2000-11-13.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.208
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1ffua1, d1ffua2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1ffub1, d1ffub2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1ffuc1, d1ffuc2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1ffud1, d1ffud2
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1ffue1, d1ffue2
  • Chain 'F':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1ffuf1, d1ffuf2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffuA (A:)
    kkiitvnvngkaqekaveprtllihflreelnltgahigcetshcgactvdidgrsvksc
    thlavqcdgsevltveglankgvlhavqegfykehglqcgfctpgmlmrayrflqenpnp
    teaeirmgmtgnlcrctgyqnivkavqyaarklqe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffuB (B:)
    daearelalagmgasrlrkedarfiqgkgnyvddikmpgmlhmdivrapiahgrikkihk
    daalampgvhavltaedlkplklhwmptlagdvaavladekvhfqmqevaiviaddryia
    adaveavkveydelpvvidpidalkpdapvlredlagktsgahgprehhnhiftwgagdk
    aatdavfanapvtvsqhmyyprvhpcpletcgcvasfdpikgdlttyitsqaphvvrtvv
    smlsgipeskvrivspdigggfgnkvgiypgyvcaivasivlgrpvkwvedrvenistta
    fardyhmdgelaatpdgkilglrvnvvadhgafdacadptkfpaglfhicsgsydiprah
    csvkgvytnkapggvayrcsfrvteavyliermvdvlaqklnmdkaeiraknfirkeqfp
    yttqfgfeydsgdyhtalkkvldavdypalraeqaarradpnsptlmgiglvtftevvga
    gpskmcdilgvgmfdsceirihptgsaiarmgtitqgqghqttyaqiiatelgipseviq
    veegdtstapyglgtygsrstpvagaaialaarkihakarkiaahmlevnendldwevdr
    fkvkgddskfktmadiawqayhqppaglepgleavhyydppnftypfgiylcvvdidrat
    getkvrrfyalddcgtrinpmiiegqihggltegyavamgqqmpfdaqgnllgntlmdyf
    lptavetphwetdhtvtpsphhpigakgvaesphvgsiptftaavvdafahvgvthldmp
    htsyrvwkslkehnlal
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffuC (C:)
    mipprfeyhapksvgeavallgqlgsdakllagghsllpmmklrfaqpehlidinripel
    rgireegstvvigamtvendlisspivqarlpllaeaakliadpqvrnrgtiggdiahgd
    pgndhpalsiaveahfvlegpngrrtvpadgfflgtymtlleenevmveirvpafaagtg
    wayeklkrktgdwatagcavvmrksggtvshirialtnvaptalraeaaeaallgkaftk
    eavqaaadaaiaicepaedlrgdadyktamagqmvkralnaawarca
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffuD (D:)
    akkiitvnvngkaqekaveprtllihflreelnltgahigcetshcgactvdidgrsvks
    cthlavqcdgsevltveglankgvlhavqegfykehglqcgfctpgmlmrayrflqenpn
    pteaeirmgmtgnlcrctgyqnivkavqyaarklqe
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffuE (E:)
    daearelalagmgasrlrkedarfiqgkgnyvddikmpgmlhmdivrapiahgrikkihk
    daalampgvhavltaedlkplklhwmptlagdvaavladekvhfqmqevaiviaddryia
    adaveavkveydelpvvidpidalkpdapvlredlagktsgahgprehhnhiftwgagdk
    aatdavfanapvtvsqhmyyprvhpcpletcgcvasfdpikgdlttyitsqaphvvrtvv
    smlsgipeskvrivspdigggfgnkvgiypgyvcaivasivlgrpvkwvedrvenistta
    fardyhmdgelaatpdgkilglrvnvvadhgafdacadptkfpaglfhicsgsydiprah
    csvkgvytnkapggvayrcsfrvteavyliermvdvlaqklnmdkaeiraknfirkeqfp
    yttqfgfeydsgdyhtalkkvldavdypalraeqaarradpnsptlmgiglvtftevvga
    gpskmcdilgvgmfdsceirihptgsaiarmgtitqgqghqttyaqiiatelgipseviq
    veegdtstapyglgtygsrstpvagaaialaarkihakarkiaahmlevnendldwevdr
    fkvkgddskfktmadiawqayhqppaglepgleavhyydppnftypfgiylcvvdidrat
    getkvrrfyalddcgtrinpmiiegqihggltegyavamgqqmpfdaqgnllgntlmdyf
    lptavetphwetdhtvtpsphhpigakgvaesphvgsiptftaavvdafahvgvthldmp
    htsyrvwkslkehnlal
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffuF (F:)
    mipprfeyhapksvgeavallgqlgsdakllagghsllpmmklrfaqpehlidinripel
    rgireegstvvigamtvendlisspivqarlpllaeaakliadpqvrnrgtiggdiahgd
    pgndhpalsiaveahfvlegpngrrtvpadgfflgtymtlleenevmveirvpafaagtg
    wayeklkrktgdwatagcavvmrksggtvshirialtnvaptalraeaaeaallgkaftk
    eavqaaadaaiaicepaedlrgdadyktamagqmvkralnaawarca