PDB entry 1ffp

View 1ffp on RCSB PDB site
Description: crystal structure of murine class i h-2db complexed with peptide gp33 (c9m/k1s)
Deposited on 2000-07-25, released 2002-12-11
The last revision prior to the SCOP 1.71 freeze date was dated 2002-12-11, with a file datestamp of 2002-12-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.25
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffpA (A:)
    phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
    retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
    dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
    tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
    qkwasvvvplgkeqnytcrvyheglpepltlrw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffpB (B:)
    miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
    wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffpD (D:)
    phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
    retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
    dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
    tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
    qkwasvvvplgkeqnytcrvyheglpepltlrw
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffpE (E:)
    miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
    wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm