PDB entry 1ffk

View 1ffk on RCSB PDB site
Description:
Deposited on 2000-07-25, released 2000-08-14
The last revision prior to the SCOP 1.71 freeze date was dated 2001-09-26, with a file datestamp of 2001-09-26.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.252
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ffk11, d1ffk12
  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ffka1, d1ffka2
  • Chain 'B':
    Compound:
    Species:
    Gene:
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ffkc_
  • Chain 'D':
    Compound:
    Species:
    Gene:
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ffke_
  • Chain 'F':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ffkf_
  • Chain 'G':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ffkg_
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ffkh_
  • Chain 'I':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ffki_
  • Chain 'J':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ffkj_
  • Chain 'K':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ffkk_
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ffkl_
  • Chain 'M':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ffkm_
  • Chain 'N':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ffkn_
  • Chain 'O':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ffko_
  • Chain 'P':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ffkp_
  • Chain 'Q':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ffkq_
  • Chain 'R':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ffkr_
  • Chain 'S':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ffks_
  • Chain 'T':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ffkt_
  • Chain 'U':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ffku_
  • Chain 'V':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ffkv_
  • Chain 'W':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ffkw_
  • Chain 'X':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ffkx_
  • Chain 'Y':
    Compound:
    Species:
    Gene:
  • Chain 'Z':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ffkz_

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1ffk1 (1:)
    prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
    tigtfqshienmfhgvtegweygmevfyshfpmqvnvegdevvienflgekaprrttihg
    dtdveidgeeltvsgpdieavgqtaadieqltrindkdvrvfqdgvyitrkpnrgda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ffk1 (1:)
    prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
    tigtfqshienmfhgvtegweygmevfyshfpmqvnvegdevvienflgekaprrttihg
    dtdveidgeeltvsgpdieavgqtaadieqltrindkdvrvfqdgvyitrkp
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ffkA (A:)
    grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
    edgdrrlilapegvgvgdelqvgvdaeiapgntlplaeipegvpvcnvesspgdggkfar
    asgvnaqllthdrnvavvklpsgemkrldpqcratigvvggggrtdkpfvkagnkhhkmk
    argtkwpnvrgvamnavdhpfggggrqhpgkpksisrnappgrkvgdiaskrtgrggne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ffkA (A:)
    grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
    edgdrrlilapegvgvgdelqvgvdaeiapgntlplaeipegvpvcnvesspgdggkfar
    asgvnaqllthdrnvavvklpsgemkrldpqcratigvvggggrtdkpfvkagnkhhkmk
    argtkwpnvrgvamnavdhpfggggrqhpgkpksisrnappgrkvgdiaskrtgrgg
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffkC (C:)
    meatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
    fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
    adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
    argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
    aevaer
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ffkE (E:)
    pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
    mhipeladekgvpfifveqqddlghaaglevgsaaaavtdagaaatvleeiadkveelr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ffkE (E:)
    vyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeivm
    hipeladekgvpfifveqqddlghaaglevgsaaaavtdagaaatvleeiadkveelr
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffkF (F:)
    kpgahfrnsikpaytrreyisgipgkgiaqfkmgnngagptypaqvenvvekpvqirhna
    leaarnaanrfvqnsgaaanykfrirkfpfhvireqdgdgmrapfgksvgtaarshganh
    dfiawvnpdpavefawrraymkvtptvnidsspagna
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ffkG (G:)
    msvaefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekr
    vdigndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgts
    ldrlsnikfvtlgeisetlganktw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ffkG (G:)
    aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
    gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
    lsnikfvtlgeisetlganktw
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffkH (H:)
    mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg
    tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
    fgsvasaatmiv
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffkI (I:)
    mksmyayireawkrpyegyvgelmwhrlqkwrrepavvriprptrldraralgykakkgi
    ivvrvrirrggrratrpnkgrkskkmmvnrrprkknlqwiaeeranrkypnmevlnsywv
    gedgrykwfevilvdrdhpaiksdpqlswvsrtrgrvyrgltsagrkarglrrkgrgaek
    vrpslranfrkkrr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1ffkJ (J:)
    tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
    aatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrheltl
    iaddfsegarekvegaggsveltdlgeerqaeaeetedadadee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ffkJ (J:)
    tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
    aatidvreidenvtllaaddvaedvrdvveeaddadyvkvlgagqvrheltliaddfseg
    arekvegaggsveltdlgeerqa
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffkK (K:)
    atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
    ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
    gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
    dgdiel
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffkL (L:)
    sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
    pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1ffkM (M:)
    tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
    rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
    dlydkagggefdsvadleryidanhgda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ffkM (M:)
    tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
    rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
    dlydkagggefdsvadleryida
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffkN (N:)
    pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
    gtvegkqgdaykvdivdggkektiivtaahlrrqe
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1ffkO (O:)
    gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
    qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
    eqqgrkpramgrasawnspqvdvelileepeved
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ffkO (O:)
    gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
    qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
    eqqgrkpramgrasawnspqvdvelileep
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1ffkP (P:)
    swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
    ekkavvrlsedddaqevasrigvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ffkP (P:)
    swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
    ekkavvrlsedddaqeva
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffkQ (Q:)
    skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
    evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1ffkR (R:)
    prtrecdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtargeag
    eaedea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ffkR (R:)
    recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1ffkS (S:)
    tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
    geegdlqene
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ffkS (S:)
    tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
    geegd
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffkT (T:)
    mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
    tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
    prgghdgvkhpvkeggqlgkhdtegiddlleamr
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1ffkU (U:)
    sasdfeervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawa
    rgrantpskirvraarfeeegeaiveaetae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ffkU (U:)
    dfeervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargr
    antpskirvraarfeeegeaiveae
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffkV (V:)
    qargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqrrgi
    kgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavrinskvgarkreri
    eeeaedagirvlnptyvevevse
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffkW (W:)
    ptgrfgpryglkirvrvrdveikhkkkykcpvcgfpklkrastsiwvcghcgykiaggay
    tpetvagkavmka
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffkX (X:)
    tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage
    

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffkZ (Z:)
    mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
    ptkktdlkyrcgecgkahlregwragrlefqe