PDB entry 1ffi

View 1ffi on RCSB PDB site
Description: structural implications of drug resistant mutants of hiv-1 protease: high resolution crystal structures of the mutant protease/substrate analog complexes
Class: hydrolase/hydrolase inhibitor
Keywords: hiv-1 protease, hydrolase-hydrolase inhibitor complex
Deposited on 2000-07-25, released 2001-06-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.211
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'C':
  Compound: protease retropepsin
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04587
    • engineered (6)
    • engineered (29)
    • engineered (32)
    • engineered (62)
    • engineered (66)
    • engineered (94)
  Domains in SCOPe 2.08: d1ffic_
• Chain 'D':
  Compound: protease retropepsin
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04587 (0-98)
    • engineered (6)
    • engineered (29)
    • engineered (32)
    • engineered (62)
    • engineered (66)
    • engineered (94)
  Domains in SCOPe 2.08: d1ffid_
• Heterogens: 2NC, HOH

PDB Chain Sequences:

• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ffiC (C:)
  pqitlwkrplvtikiggqlkealldtgadntvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ffiD (D:)
  pqitlwkrplvtikiggqlkealldtgadntvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf