PDB entry 1fff

View 1fff on RCSB PDB site
Description: structural implications of drug resistant mutants of hiv-1 protease : high resolution crystal structures of the mutant protease/substrate analog complexes.
Deposited on 2000-07-25, released 2001-06-01
The last revision prior to the SCOP 1.63 freeze date was dated 2001-06-01, with a file datestamp of 2001-06-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.212
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Domains in SCOP 1.63: d1fffc_
  • Chain 'D':
    Domains in SCOP 1.63: d1fffd_

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fffC (C:)
pqitlwkrplvtikiggqlkealldtgadntvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fffD (D:)
pqitlwkrplvtikiggqlkealldtgadntvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf