PDB entry 1ff9

View 1ff9 on RCSB PDB site
Description:
Deposited on 2000-07-25, released 2000-11-08
The last revision prior to the SCOP 1.67 freeze date was dated 2000-11-08, with a file datestamp of 2000-11-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.241
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1ff9a1, d1ff9a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ff9A (A:)
    matksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvndda
    aldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvm
    neigldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvl
    lalrnaasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadn
    ivrgtlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivsti
    vsnatfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvml
    qhkfeienkdgsretrtsslceygapigsggysamaklvgvpcavavkfvldgtisdrgv
    lapmnskindplmkelkekygieckekvva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ff9A (A:)
    atksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvnddaa
    ldaevakhdlvislipfhatviksairqkkhvvttsyvspammeldqaakdagitvmnei
    gldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvllal
    rnaasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadnivr
    gtlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivstivsn
    atfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvmlqhk
    feienkdgsretrtsslceygapigsggysamaklvgvpcavavkfvldgtisdrgvlap
    mnskindplmkelkekygieckekvva