PDB entry 1ff7

View 1ff7 on RCSB PDB site
Description: the first egf-like domain from human blood coagulation fvii (fucosylated at ser-60), nmr, 20 structures
Class: blood clotting
Keywords: factor vii, blood coagulation, egf-like domain, glycoprotein, fucosylation, o- linked fucose, blood clotting
Deposited on 1999-02-19, released 1999-06-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PROTEIN (Blood Coagulation Factor VII)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08709 (0-42)
      • see remark 999 (43-45)
    Domains in SCOPe 2.08: d1ff7a_
  • Heterogens: FUC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ff7A (A:)
    sdgdqcasspcqnggsckdqlqsyicfclpafegrncethkddgsa