PDB entry 1ff4

View 1ff4 on RCSB PDB site
Description: x-ray structure of muscarinic toxin 2 at 1.5 angstrom resolution
Deposited on 2000-07-25, released 2003-07-08
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-08, with a file datestamp of 2003-07-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.205
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1ff4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ff4A (A:)
    ltcvttksiggvttedcpagqnvcfkrwhyvtpknydiikgcaatcpkvdnndpirccgt
    dkcnd